PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr10P17790_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 682aa    MW: 75959 Da    PI: 7.7881
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr10P17790_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.81.1e-192171656
                            S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                Homeobox  6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                            ++t++q++eLe++F+ +++p++++r +L++ lgL+ rq+k+WFqNrR+ +k
  GSMUA_Achr10P17790_001 21 RHTSQQIQELEAMFKVCPHPDEKQRMKLSRDLGLEPRQIKFWFQNRRTLMK 71
                            789********************************************9877 PP

2START143.71.7e-451994223205
                             HHHHHHHHHHHHHHC-TT-EEEE.......EXCCTTEEEEEEESSS.....SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S. CS
                   START   3 aeeaaqelvkkalaeepgWvkss.......esengdevlqkfeeskv....dsgealrasgvvdmvlallveellddkeqWdetla. 77 
                             a +a++e+vk+++ +ep+W ks+       +se+++   q+++++++     ++ea+r s++v+m++a+lv  ++d++ +W e ++ 
  GSMUA_Achr10P17790_001 199 ASAALEEVVKLIQTNEPLWLKSAsmgtevlQSETYERIFQRPSQQQFkfsdTRTEASRGSALVIMDAATLVDMFMDSS-KWMELFPt 284
                             67899******************999999999999999999999999***99**************************.***99999 PP

                             ...EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEE CS
                   START  78 ...kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgili 154
                                   t++v+ sg      g l lm+ elq+lsp+vp R f f+Ry++q     wvi+dvSv+ + +     ++  + +lpSg+li
  GSMUA_Achr10P17790_001 285 ivsNSRTIDVLASGtsgtrsGSLLLMYEELQVLSPVVPtRHFCFLRYCQQIDPCLWVIADVSVNYPMDSRH-LPSPLSCKLPSGCLI 370
                             99999*************************************************************99985.44444449******* PP

                             EEECTCEEEEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                   START 155 epksnghskvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqce 205
                             e ++ng+skv wvehv  +++   h l+r lv+sg+ +ga++w+ tlqr  +
  GSMUA_Achr10P17790_001 371 EAMPNGYSKVSWVEHVQFQEKNTiHRLFRDLVNSGTSFGANRWLTTLQRMSQ 422
                             ******************987555************************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.0E-20767IPR009057Homeodomain-like
SuperFamilySSF466891.88E-18971IPR009057Homeodomain-like
PROSITE profilePS5007117.0861373IPR001356Homeobox domain
SMARTSM003891.2E-151377IPR001356Homeobox domain
CDDcd000861.64E-171571No hitNo description
PfamPF000463.1E-172171IPR001356Homeobox domain
PROSITE profilePS5084844.231188426IPR002913START domain
SuperFamilySSF559613.14E-30189424No hitNo description
CDDcd088757.46E-100192422No hitNo description
Gene3DG3DSA:3.30.530.201.0E-4196422IPR023393START-like domain
SMARTSM002348.0E-35197423IPR002913START domain
PfamPF018528.1E-39199422IPR002913START domain
SuperFamilySSF559615.5E-19446674No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 682 aa     Download sequence    Send to blast
MDSVGERDVS EVQRRKKRFY RHTSQQIQEL EAMFKVCPHP DEKQRMKLSR DLGLEPRQIK  60
FWFQNRRTLM KATFPFPFFS MILQSDNCSL RAENDKIRCE NITMEEALKR AVCLSCGAGP  120
PPDNPFFDEQ KLRMENTRLK EEVDRLSEIA SRYLGRPITQ LPSSQRLSVS QSESSSSVLS  180
NPSPTTISDL EKPIMMDMAS AALEEVVKLI QTNEPLWLKS ASMGTEVLQS ETYERIFQRP  240
SQQQFKFSDT RTEASRGSAL VIMDAATLVD MFMDSSKWME LFPTIVSNSR TIDVLASGTS  300
GTRSGSLLLM YEELQVLSPV VPTRHFCFLR YCQQIDPCLW VIADVSVNYP MDSRHLPSPL  360
SCKLPSGCLI EAMPNGYSKV SWVEHVQFQE KNTIHRLFRD LVNSGTSFGA NRWLTTLQRM  420
SQRFACLMSA GLSTRDIAGA VPSVEAKKSM MKLAHRLVMD FCASFSASVG NKWTMLSGIN  480
DDLRVTLHRT DSSLPHGVVL SAATSIWLPL PRDRVFSFLK DEQNRPQWDV FSIGNNLQKV  540
AHITNGSDQG NAISILRGLN YTHNMLILQE SCTDASGSVV VYSPIDLPAM NTIMSGEDPS  600
YIHILPSGFT ILPDGRFGVG GGASTSSCPT GRPSGSLVTV AFQMLMSSSP GAKLSFESIA  660
TVNNSISNTI HQIKAALSCP SV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009380061.10.0PREDICTED: homeobox-leucine zipper protein ROC8-like
SwissprotQ69T580.0ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8
TrEMBLM0RJ540.0M0RJ54_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P17790_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29123770
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17920.10.0homeodomain GLABROUS 12